PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn138351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 554aa    MW: 61909.8 Da    PI: 4.6561
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn138351genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.34e-25124171552
      RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +s +++s+yF++pi++AAkeL v+lT+LK++CR++GI+RWPhRk+ sl
  Achn138351 124 LSRNTISQYFYMPITQAAKELHVGLTLLKKRCRELGIRRWPHRKLMSL 171
                 67899****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.802107192IPR003035RWP-RK domain
PfamPF020425.8E-21124171IPR003035RWP-RK domain
PROSITE profilePS5129219.615345405IPR011016Zinc finger, RING-CH-type
SuperFamilySSF578501.24E-13351401No hitNo description
SMARTSM007441.5E-18352399IPR011016Zinc finger, RING-CH-type
Gene3DG3DSA:3.30.40.101.1E-16352400IPR013083Zinc finger, RING/FYVE/PHD-type
PfamPF129065.4E-12353398IPR011016Zinc finger, RING-CH-type
PfamPF124287.3E-21421503IPR022143Protein of unknown function DUF3675
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MAKQEEYQEA FTFPILPLNF SGYSALDCEY DLSVQESTVF DALLLCSPMD LVPTPNAIQE  60
EFLLAYGNGF GVCNDHEMSS TRFGFEPQSQ PLLLCNNESS THEEYVVGEK KVQRCTNSSK  120
MIVLSRNTIS QYFYMPITQA AKELHVGLTL LKKRCRELGI RRWPHRKLMS LQTLIKNVQE  180
MGKGEGDGDE GRCREAIDIL EQERKLVEES PDTQLHHKTK RLRQECFKAN YKKRKLMGMN  240
MVMVESHDSS STSTNLVNSD AVDQDYDHRV DDDDGDEGEE MSESGFLLSR IVMWEHLVDH  300
LITPKSLQSL QGAEVPGSSR CHTIDPSTSI DMKDVEEYVG ADEEEPLIQM VECRICQEED  360
SIQNLEIPCA CSGSLKFAHR KCVQRWCNEK GDITCEICHQ LLYDVANDCP SPHFTKNTVK  420
ENSFSGDWTI SGSHLNLHDP RLLAMAAAER RLLEAQYDES ADANAGGFAF FRVAVLILMA  480
LLLLRHALTI TTDDDDDAST IFSEAAAAAA ALTATEVAFM IQGAQRRGLQ VTVAPRPTPT  540
PGPAPSPHQE QVQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-44RWP-RK domain-containing protein